Web Server Statistics for [bioinformatics.pzr.uni-rostock.de]

Program started at Sat-27-Apr-2013 16:38.
Analysed requests from Sun-22-Apr-2012 06:26 to Sat-27-Apr-2013 10:38 (370.18 days).

General Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report contains overall statistics.

Figures in parentheses refer to the 7-day period ending 27-Apr-2013 16:38.

Successful requests: 177,032 (3,298)
Average successful requests per day: 478 (471)
Successful requests for pages: 103,820 (2,091)
Average successful requests for pages per day: 280 (298)
Failed requests: 34,342 (386)
Redirected requests: 1,226 (40)
Distinct files requested: 1,828 (496)
Distinct hosts served: 10,930 (496)
Unwanted logfile entries: 4
Data transferred: 9.93 gigabytes (113.86 megabytes)
Average data transferred per day: 27.48 megabytes (16.27 megabytes)

Monthly Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the activity in each month.

Each unit (+) represents 300 requests for pages or part thereof.

monthreqspages 
Apr 201241092086+++++++
May 20121773210635++++++++++++++++++++++++++++++++++++
Jun 2012127336442++++++++++++++++++++++
Jul 2012151548888++++++++++++++++++++++++++++++
Aug 2012123486697+++++++++++++++++++++++
Sep 2012123575857++++++++++++++++++++
Oct 2012146757682++++++++++++++++++++++++++
Nov 2012147849356++++++++++++++++++++++++++++++++
Dec 2012134848531+++++++++++++++++++++++++++++
    
Jan 20131674310773++++++++++++++++++++++++++++++++++++
Feb 2013145368751++++++++++++++++++++++++++++++
Mar 2013151409642+++++++++++++++++++++++++++++++++
Apr 2013132378480+++++++++++++++++++++++++++++

Busiest month: Jan 2013 (10,773 requests for pages).

Daily Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each day of the week, summed over all the weeks in the report.

Each unit (+) represents 500 requests for pages or part thereof.

dayreqspages 
Sun2068613331+++++++++++++++++++++++++++
Mon2692215448+++++++++++++++++++++++++++++++
Tue3235620327+++++++++++++++++++++++++++++++++++++++++
Wed2582513717++++++++++++++++++++++++++++
Thu2274211263+++++++++++++++++++++++
Fri2921317675++++++++++++++++++++++++++++++++++++
Sat1928812059+++++++++++++++++++++++++

Hourly Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each hour of the day, summed over all the days in the report.

Each unit (+) represents 150 requests for pages or part thereof.

hourreqspages 
053993629+++++++++++++++++++++++++
151223377+++++++++++++++++++++++
257423808++++++++++++++++++++++++++
356993841++++++++++++++++++++++++++
463564538+++++++++++++++++++++++++++++++
558073984+++++++++++++++++++++++++++
692834482++++++++++++++++++++++++++++++
769973907+++++++++++++++++++++++++++
871144175++++++++++++++++++++++++++++
969073532++++++++++++++++++++++++
1093535176+++++++++++++++++++++++++++++++++++
1186924500++++++++++++++++++++++++++++++
1287394931+++++++++++++++++++++++++++++++++
1384234497++++++++++++++++++++++++++++++
1488884533+++++++++++++++++++++++++++++++
1579293668+++++++++++++++++++++++++
1681404201+++++++++++++++++++++++++++++
1773113889++++++++++++++++++++++++++
1865103648+++++++++++++++++++++++++
1982905168+++++++++++++++++++++++++++++++++++
2094336851++++++++++++++++++++++++++++++++++++++++++++++
2172554626+++++++++++++++++++++++++++++++
2276754911+++++++++++++++++++++++++++++++++
2359683948+++++++++++++++++++++++++++

Domain Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the countries of the computers which requested files.

Listing domains, sorted by the amount of traffic.

reqs%bytesdomain
5790044.26%.com (Commercial)
3240316.85%[unresolved numerical addresses]
3299810.59%.de (Germany)
33845 9.43%.net (Networks)
1354 3.72%.pl (Poland)
193 3.15%.nz (New Zealand)
4782 2.04%.edu (USA Higher Education)
106 1.77%.cn (China)
560 0.94%.nl (Netherlands)
3832 0.91%.ru (Russia)
627 0.67%.uk (United Kingdom)
741 0.48%.it (Italy)
383 0.43%.au (Australia)
246 0.40%[unknown domain]
348 0.39%.br (Brazil)
126 0.38%.be (Belgium)
226 0.28%.in (India)
472 0.27%.cz (Czech Republic)
102 0.27%.mx (Mexico)
63 0.20%.tw (Taiwan)
125 0.17%.pt (Portugal)
538 0.17%.tr (Turkey)
295 0.15%.ca (Canada)
5 0.14%.ir (Iran)
322 0.14%.jp (Japan)
28 0.13%.us (United States)
7 0.13%.sk (Slovakia)
82 0.13%.gov (USA Government)
688 0.12%.ua (Ukraine)
95 0.12%.gr (Greece)
386 0.12%.fr (France)
217 0.11%.ch (Switzerland)
227 0.11%.se (Sweden)
60 0.10%.co (Colombia)
257 0.09%.ro (Romania)
320 0.08%.id (Indonesia)
66 0.05%.il (Israel)
50 0.05%.ar (Argentina)
46 0.05%.cu (Cuba)
4 0.05%.al (Albania)
1 0.05%.uz (Uzbekistan)
56 0.04%.za (South Africa)
297 0.04%.org (Non Profit Making Organisations)
9 0.03%.ly (Libya)
128 0.03%.no (Norway)
132 0.02%.fi (Finland)
2 0.02%.hk (Hong Kong)
12 0.02%.sg (Singapore)
277 0.02%.es (Spain)
43 0.02%.info (Informational)
85 0.01%.pk (Pakistan)
97 0.01%.cl (Chile)
41 0.01%.th (Thailand)
121 .at (Austria)
35 .dk (Denmark)
21 [domain not given]
15 .io (British Indian Ocean Territory)
44 .ie (Ireland)
147 .tv (Tuvalu)
17 .my (Malaysia)
15 .na (Namibia)
13 .su (Former USSR)
4 .biz (Businesses)
34 .si (Slovenia)
1 .md (Moldova)
24 .hu (Hungary)
31 .arpa (Arpanet)
50 .vn (Vietnam)
17 .ae (United Arab Emirates)
9 .ge (Georgia)
8 .sa (Saudi Arabia)
17 .lv (Latvia)
10 .gh (Ghana)
19 .ee (Estonia)
8 .lu (Luxembourg)
22 .ye (Yemen)
4 .ph (Philippines)
5 .by (Belarus)
6 .name (Individuals)
11 .kz (Kazakhstan)
2 .gt (Guatemala)
1 .bn (Brunei Darussalam)
1 .jo (Jordan)
1 .uy (Uruguay)
4 .hr (Croatia)
5 .mil (USA Military)
3 .lt (Lithuania)
1 .is (Iceland)
1 .ec (Ecuador)

Organisation Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the organisations of the computers which requested files.

Listing the top 20 organisations by the number of requests, sorted by the number of requests.

reqs%bytesorganisation
26753 5.34%sistrix.net
15067 1.63%baidu.com
14498 2.61%uni-rostock.de
14259 9.16%msn.com
1240625.35%googlebot.com
9135 0.90%220.181
4593 2.51%yandex.com
4367 0.85%your-server.de
3709 1.55%sdsc.edu
3396 2.14%amazonaws.com
3276 0.64%yandex.ru
2876 0.40%t-ipconnect.de
2689 0.19%119
2667 0.27%superkabel.de
1654 0.24%208.115
1535 0.18%wowrack.com
1434 2.72%yasni.de
1258 0.17%180.76
948 0.54%serverloft.de
924 0.05%arcor-ip.net
4958842.55%[not listed: 2,322 organisations]

Search Word Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists which words people used in search engines to find the site.

Listing the top 30 query words by the number of requests, sorted by the number of requests.

reqssearch term
472rostock
356sclerosis
356multiple
253of
228http://bioinformatics.pzr.uni
226in
196dna
180inverted
157repeats
146find
134repeat
129qtl
125proteom
105center
103the
103finder
101linkage
100glocker
100proteome
97zentrum
89immunopathogenesis
88and
88new
80sequence
78palindrome
71rostock.de/~serrano/papers/pdfs/pathways/others/hemmer%202002.pdf
71search
70rostock.de/~serrano/papers/pdfs/viral_bacterial/derfuss%202001.pdf
70concepts
69steffen
4487[not listed: 1,226 search terms]

Operating System Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the operating systems used by visitors.

Listing operating systems, sorted by the number of requests for pages.

no.reqspagesOS
16946059797Known robots
24429624775OS unknown
35166814002Windows
 248647158  Unknown Windows
 258426266  Windows XP
 388170  Windows Server 2003
 232138  Windows 2000
 9484  Windows 95
 10975  Windows NT
 5751  Windows 98
 6651  Windows ME
 126  Windows CE
 43  Windows 3.1
447552638Unix
 47512636  Linux
 31  SunOS
 11  BSD
556161917Macintosh
671Symbian OS
711Amiga

Status Code Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the HTTP status codes of all requests.

Listing status codes, sorted numerically.

reqsstatus code
169721200 OK
2080206 Partial content
1203301 Document moved permanently
23303 See other document
5231304 Not modified since last retrieval
2013400 Bad request
781403 Access forbidden
30245404 Document not found
125405 Method not allowed
8500 Internal server error
1170501 Request type not supported

File Size Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the sizes of files.

sizereqs%bytes
06279 
1B- 10B43 
11B- 100B13338 0.01%
101B- 1kB37691 0.15%
1kB- 10kB73981 2.89%
10kB-100kB39338 9.14%
100kB- 1MB471714.14%
1MB- 10MB151644.23%
10MB-100MB12929.44%

File Type Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the extensions of files.

Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.

reqs%bytesextension
651957.08%.pdf [Adobe Portable Document Format]
641810.76%.html [Hypertext Markup Language]
62410.31%.gz [Gzip compressed files]
27 4.63%  .fasta.gz
319 3.20%  .sql.gz
174 2.48%  .tar.gz [Compressed archives]
452 6.10%.doc [Microsoft Word document]
52081 4.48%[directories]
45213 4.47%.php [PHP]
15031 1.28%.jpg [JPEG graphics]
4506 1.11%.png [PNG graphics]
8611 0.99%.gif [GIF graphics]
177 0.79%.ppt
36 0.55%.tif
47 0.35%.odt
7843 0.34%.shtml [Server-parsed HTML]
397 0.33%.xml
18023 0.27%.txt [Plain text]
1557 0.26%.jpeg [JPEG graphics]
129 0.15%.aln
2235 0.14%.css [Cascading Style Sheets]
7133 0.23%[not listed: 14 extensions]

Directory Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the directories from which files were requested. (The figures for each directory include all of its subdirectories.)

Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.

reqs%bytesdirectory
1168750.74%/~serrano/
10277811.86%[root directory]
84111.36%/proteinatlas/
2014711.19%/~moeller/
22758 5.68%/qtl/
2122 4.45%/download/
2005 1.71%/gele/
506 1.08%/work_go/
1199 0.83%/supplements/
510 0.35%/bilder/
691 0.26%/available/
5697 0.20%/images/
1500 0.10%/goery/
205 0.05%/flexy/
755 0.04%/intern/
649 0.04%/ProteomForum/
400 0.03%/~kreutzer/
546 0.02%/~gfischer/
2036 0.02%[not listed: 12 directories]

Request Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the files on the site.

Listing files with at least 20 requests, sorted by the number of requests.

reqs%byteslast timefile
37904 3.37%27/Apr/13 09:42/
208 0.03%24/Apr/13 03:27  /?ref=%C4%B0lkSexShop.Com
118 0.02%24/Apr/13 03:27  /?page=http://footshop.ir/images/Fair-D.I.F-2011/byroe.jpg??
57 0.01%27/Apr/13 01:11  /?id=18
17094 0.03%27/Apr/13 10:38/robots.txt
8431 0.39%26/Apr/13 21:10/qtl/graphclaudia.php
173 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
154 25/Apr/13 21:16  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
150 0.02%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
146 0.03%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
143 0.02%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
140 0.04%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
128 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&reg=&species=Mus_musculus&win=20&x_value=0
126 0.02%26/Apr/13 21:10  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
123 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
122 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
121 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
120 24/Apr/13 11:00  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
119 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
119 0.02%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
119 0.04%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
119 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mrk&bands=&chr=1&cmap=&map=MIT_Genetic_map&out=20&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
118 24/Apr/13 11:12  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
117 24/Apr/13 10:49  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
117 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
116 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mrk&bands=&chr=1&cmap=&map=MIT_Genetic_map&out=20&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
116 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
115 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
115 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
115 24/Apr/13 09:56  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
115 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
113 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
113 24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
112 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
109 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
109 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&reg=&species=Mus_musculus&win=20&x_value=0
107 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
107 24/Apr/13 10:49  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
107 24/Apr/13 09:57  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
105 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
102 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
100 24/Apr/13 09:57  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
100 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
99 24/Apr/13 11:12  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
99 24/Apr/13 09:57  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
99 24/Apr/13 10:41  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
99 24/Apr/13 09:56  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
98 24/Apr/13 11:00  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
98 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
98 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
97 26/Apr/13 16:24  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
96 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
96 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&reg=&species=Mus_musculus&win=20&x_value=0
95 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mrk&bands=&chr=1&cmap=&map=MIT_Genetic_map&out=20&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
93 0.04%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
92 0.02%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
92 24/Apr/13 09:57  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
92 24/Apr/13 11:12  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
91 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
91 24/Apr/13 10:49  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
91 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
91 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&reg=&species=Mus_musculus&win=20&x_value=0
91 0.03%24/Apr/13 03:27  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
90 24/Apr/13 09:57  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
88 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&reg=&species=Mus_musculus&win=20&x_value=0
86 0.04%24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mit&bands=&chr=2&cmap=&map=MIT_Genetic_map&out=50&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
84 24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mrk&bands=&chr=1&cmap=&map=MIT_Genetic_map&out=20&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
84 0.03%24/Apr/13 03:27  /qtl/graphclaudia.php?MRK=mrk&bands=&chr=1&cmap=&map=MIT_Genetic_map&out=20&ps=1&reg=&species=Mus_musculus&win=20&x_value=0
83 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
82 24/Apr/13 09:56  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
82 24/Apr/13 11:12  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
81 24/Apr/13 10:49  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
81 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
81 24/Apr/13 10:28  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
81 24/Apr/13 10:41  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
81 24/Apr/13 10:25  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
81 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
81 24/Apr/13 10:49  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
80 24/Apr/13 10:00  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
80 24/Apr/13 10:41  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
80 24/Apr/13 09:58  /qtl/graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
80 24/Apr/13 10:41  /qtl/graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
80 24/Apr/13 11:00  /qtl/graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
5499 0.11%27/Apr/13 03:34/qtl/qtl_group.php
158 0.01%24/Apr/13 03:27  /qtl/qtl_group.php?order=id
155 0.01%24/Apr/13 03:27  /qtl/qtl_group.php?order=name
153 24/Apr/13 03:27  /qtl/qtl_group.php?name=EAE
153 0.01%26/Apr/13 03:33  /qtl/qtl_group.php?order=links
153 0.01%24/Apr/13 03:27  /qtl/qtl_group.php?order=description
152 26/Apr/13 23:54  /qtl/qtl_group.php?id=9
150 26/Apr/13 23:45  /qtl/qtl_group.php?name=BBAA
149 0.01%24/Apr/13 03:27  /qtl/qtl_group.php?order=species_name
148 26/Apr/13 23:45  /qtl/qtl_group.php?id=20
147 27/Apr/13 00:49  /qtl/qtl_group.php?id=7
147 26/Apr/13 23:47  /qtl/qtl_group.php?name=LA
146 27/Apr/13 00:11  /qtl/qtl_group.php?id=16
146 26/Apr/13 23:47  /qtl/qtl_group.php?id=19
145 24/Apr/13 03:27  /qtl/qtl_group.php?name=TMEVD
144 24/Apr/13 03:27  /qtl/qtl_group.php?id=13
144 24/Apr/13 03:27  /qtl/qtl_group.php?name=PGIA
144 27/Apr/13 03:34  /qtl/qtl_group.php?name=ATH
143 24/Apr/13 03:27  /qtl/qtl_group.php?id=12
143 24/Apr/13 03:27  /qtl/qtl_group.php?id=14
143 26/Apr/13 23:49  /qtl/qtl_group.php?id=21
141 27/Apr/13 00:11  /qtl/qtl_group.php?id=8
141 24/Apr/13 03:27  /qtl/qtl_group.php?name=STIA
141 26/Apr/13 23:49  /qtl/qtl_group.php?id=15
141 24/Apr/13 03:27  /qtl/qtl_group.php?id=1
140 24/Apr/13 03:27  /qtl/qtl_group.php?name=RA
139 26/Apr/13 09:32  /qtl/qtl_group.php?name=TMEVP
139 26/Apr/13 23:45  /qtl/qtl_group.php?id=18
139 26/Apr/13 23:54  /qtl/qtl_group.php?id=2
139 26/Apr/13 23:47  /qtl/qtl_group.php?id=3
139 26/Apr/13 23:47  /qtl/qtl_group.php?id=5
138 26/Apr/13 23:47  /qtl/qtl_group.php?id=17
137 24/Apr/13 03:27  /qtl/qtl_group.php?name=PAAM
137 26/Apr/13 23:54  /qtl/qtl_group.php?id=4
136 27/Apr/13 00:17  /qtl/qtl_group.php?id=6
136 27/Apr/13 00:11  /qtl/qtl_group.php?id=11
135 26/Apr/13 23:54  /qtl/qtl_group.php?name=CIA
133 24/Apr/13 03:27  /qtl/qtl_group.php?id=10
5360 0.11%27/Apr/13 08:19/qtl_group.php
247 27/Apr/13 08:19  /qtl_group.php?name=EAE
219 27/Apr/13 08:19  /qtl_group.php?name=CIA
156 27/Apr/13 08:19  /qtl_group.php?id=7
155 0.01%27/Apr/13 03:35  /qtl_group.php?order=links
152 0.01%24/Apr/13 19:48  /qtl_group.php?order=id
149 27/Apr/13 08:19  /qtl_group.php?id=18
146 0.01%24/Apr/13 19:48  /qtl_group.php?order=description
145 0.01%24/Apr/13 19:48  /qtl_group.php?order=species_name
145 25/Apr/13 13:39  /qtl_group.php?name=PGIA
142 27/Apr/13 08:19  /qtl_group.php?id=1
141 0.01%24/Apr/13 19:48  /qtl_group.php?order=name
136 26/Apr/13 15:19  /qtl_group.php?name=STIA
136 27/Apr/13 08:19  /qtl_group.php?id=2
135 27/Apr/13 08:19  /qtl_group.php?id=9
132 27/Apr/13 08:19  /qtl_group.php?id=10
132 27/Apr/13 08:19  /qtl_group.php?id=11
131 24/Apr/13 19:48  /qtl_group.php?name=TMEVD
128 27/Apr/13 08:19  /qtl_group.php?id=14
127 27/Apr/13 08:19  /qtl_group.php?id=20
125 27/Apr/13 08:19  /qtl_group.php?id=4
125 27/Apr/13 08:19  /qtl_group.php?id=6
125 27/Apr/13 08:19  /qtl_group.php?id=16
124 27/Apr/13 08:19  /qtl_group.php?id=3
123 27/Apr/13 08:19  /qtl_group.php?id=8
123 27/Apr/13 08:19  /qtl_group.php?id=21
122 27/Apr/13 08:19  /qtl_group.php?id=13
120 24/Apr/13 19:48  /qtl_group.php?name=LA
120 24/Apr/13 19:48  /qtl_group.php?name=ATH
118 27/Apr/13 08:19  /qtl_group.php?id=15
117 27/Apr/13 08:19  /qtl_group.php?id=12
116 24/Apr/13 19:48  /qtl_group.php?name=PAAM
116 27/Apr/13 08:19  /qtl_group.php?id=5
115 24/Apr/13 19:48  /qtl_group.php?name=BBAA
115 27/Apr/13 08:19  /qtl_group.php?id=17
115 27/Apr/13 08:19  /qtl_group.php?id=19
110 24/Apr/13 19:48  /qtl_group.php?name=TMEVP
105 25/Apr/13 15:26  /qtl_group.php?name=RA
5218 0.12%27/Apr/13 03:29/index.shtml
4812 0.34%27/Apr/13 02:53/qtl/qtl.php
112 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=2
112 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=4
112 0.01%24/Apr/13 10:25  /qtl/qtl.php?species=Mus musculus&metatrait=5
111 0.01%24/Apr/13 10:41  /qtl/qtl.php?species=Mus musculus&metatrait=7
110 0.01%24/Apr/13 11:12  /qtl/qtl.php?species=Mus musculus&metatrait=1
110 0.01%24/Apr/13 11:00  /qtl/qtl.php?species=Mus musculus&metatrait=9
110 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=10
107 0.01%26/Apr/13 23:46  /qtl/qtl.php?species=Mus musculus&metatrait=9
106 0.01%24/Apr/13 11:00  /qtl/qtl.php?species=Mus musculus&metatrait=4
104 0.01%24/Apr/13 09:58  /qtl/qtl.php?species=Mus musculus&metatrait=2
104 0.01%25/Apr/13 02:20  /qtl/qtl.php?species=Mus musculus&metatrait=9
103 0.01%24/Apr/13 10:00  /qtl/qtl.php?species=Mus musculus&metatrait=10
103 0.01%24/Apr/13 11:12  /qtl/qtl.php?species=Mus musculus&metatrait=1
103 0.01%27/Apr/13 01:30  /qtl/qtl.php?species=Mus musculus&metatrait=3
102 0.01%24/Apr/13 09:58  /qtl/qtl.php?species=Mus musculus&metatrait=5
102 0.01%24/Apr/13 09:57  /qtl/qtl.php?species=Mus musculus&metatrait=7
101 0.01%24/Apr/13 10:00  /qtl/qtl.php?species=Mus musculus&metatrait=6
101 0.01%24/Apr/13 10:25  /qtl/qtl.php?species=Mus musculus&metatrait=8
99 0.01%27/Apr/13 00:16  /qtl/qtl.php?species=Rattus norvegicus&metatrait=11
99 24/Apr/13 03:27  /qtl/qtl.php?species=Mus musculus&metatrait=4
98 0.01%24/Apr/13 03:27  /qtl/qtl.php?species=Mus musculus&metatrait=3
95 26/Apr/13 00:44  /qtl/qtl.php?species=Mus musculus&metatrait=5
95 0.01%27/Apr/13 00:21  /qtl/qtl.php?species=Mus musculus&metatrait=8
92 27/Apr/13 00:11  /qtl/qtl.php?species=Rattus norvegicus&metatrait=11
91 0.01%24/Apr/13 10:25  /qtl/qtl.php?species=Mus musculus&metatrait=10
91 0.01%25/Apr/13 00:25  /qtl/qtl.php?species=Mus musculus&metatrait=2
91 24/Apr/13 09:57  /qtl/qtl.php?species=Mus musculus&metatrait=1
91 24/Apr/13 03:27  /qtl/qtl.php?species=Mus musculus&metatrait=2
91 26/Apr/13 23:49  /qtl/qtl.php?species=Mus musculus&metatrait=7
89 26/Apr/13 23:45  /qtl/qtl.php?species=Mus musculus&metatrait=6
88 0.01%24/Apr/13 10:41  /qtl/qtl.php?species=Mus musculus&metatrait=1
88 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=4
88 0.01%24/Apr/13 10:25  /qtl/qtl.php?species=Mus musculus&metatrait=5
88 0.01%24/Apr/13 09:58  /qtl/qtl.php?species=Mus musculus&metatrait=9
88 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=3
87 0.01%24/Apr/13 10:00  /qtl/qtl.php?species=Mus musculus&metatrait=7
86 24/Apr/13 09:58  /qtl/qtl.php?species=Mus musculus&metatrait=10
82 0.01%27/Apr/13 00:11  /qtl/qtl.php?species=Rattus norvegicus&metatrait=11
81 0.01%24/Apr/13 09:57  /qtl/qtl.php?species=Mus musculus&metatrait=5
80 0.01%24/Apr/13 10:49  /qtl/qtl.php?species=Mus musculus&metatrait=8
79 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=7
79 0.01%24/Apr/13 10:28  /qtl/qtl.php?species=Mus musculus&metatrait=6
78 0.01%24/Apr/13 09:58  /qtl/qtl.php?species=Mus musculus&metatrait=1
78 0.01%24/Apr/13 11:12  /qtl/qtl.php?species=Mus musculus&metatrait=9
77 0.01%24/Apr/13 09:56  /qtl/qtl.php?species=Mus musculus&metatrait=10
77 0.01%27/Apr/13 02:53  /qtl/qtl.php?species=Mus musculus&metatrait=3
76 0.01%24/Apr/13 10:28  /qtl/qtl.php?species=Mus musculus&metatrait=2
76 0.01%24/Apr/13 10:41  /qtl/qtl.php?species=Mus musculus&metatrait=4
4513 0.01%27/Apr/13 10:26/favicon.ico
3486 0.04%27/Apr/13 03:33/cartographer.php
148 24/Apr/13 19:49  /cartographer.php?chr=1&win=20&out=20&x_value=80
148 24/Apr/13 19:49  /cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
140 24/Apr/13 19:49  /cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
124 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
122 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
121 24/Apr/13 03:27  /cartographer.php?chr=1&win=20&out=20&x_value=80
120 24/Apr/13 03:27  /cartographer.php?chr=1&win=20&out=20&x_value=80
120 24/Apr/13 17:28  /cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
120 24/Apr/13 03:27  /cartographer.php?species=Homo_sapiens&chr=1&map=MIT_Genetic_map&MRK=mrk&win=20&out=20&x_value=
117 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
112 24/Apr/13 03:27  /cartographer.php?species=Homo_sapiens&chr=1&map=MIT_Genetic_map&MRK=mrk&win=20&out=20&x_value=
108 25/Apr/13 23:30  /cartographer.php?chr=2&amp
105 25/Apr/13 21:36  /cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
104 24/Apr/13 03:27  /cartographer.php?chr=1&win=20&out=20&x_value=80
102 24/Apr/13 07:44  /cartographer.php?species=Homo_sapiens&chr=1&map=MIT_Genetic_map&MRK=mrk&win=20&out=20&x_value=
101 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
100 24/Apr/13 03:27  /cartographer.php?chr=2&amp
97 24/Apr/13 16:58  /cartographer.php?chr=1&win=20&out=20&x_value=80
93 24/Apr/13 03:27  /cartographer.php?species=Homo_sapiens&chr=1&map=MIT_Genetic_map&MRK=mrk&win=20&out=20&x_value=
91 24/Apr/13 03:27  /cartographer.php?chr=2&amp
91 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
90 24/Apr/13 03:27  /cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
86 24/Apr/13 03:27  /cartographer.php?species=Homo_sapiens&chr=1&map=MIT_Genetic_map&MRK=mrk&win=20&out=20&x_value=
2474 0.59%27/Apr/13 10:02/~moeller/
110 0.03%24/Apr/13 03:27  /~moeller/?page=http://footshop.ir/images/Fair-D.I.F-2011/byroe.jpg??
2235 0.10%27/Apr/13 02:39/~moeller/7tmhmm/submission.php
112 0.01%24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=
102 27/Apr/13 00:49  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=>Alpha-1A adrenergic receptor@_NEWLINE_@ACHRHLHSVTHYYIV|DRYIGVSYPLRYPTIVTQRRGLM|RVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLG|SQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
102 0.01%24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=>Alpha-1A adrenergic receptor@_NEWLINE_@ACHRHLHSVTHYYIV|DRYIGVSYPLRYPTIVTQRRGLM|RVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLG|SQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
100 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=
97 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=
95 26/Apr/13 23:54  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A
94 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=>Alpha-1A adrenergic receptor@_NEWLINE_@ACHRHLHSVTHYYIV|DRYIGVSYPLRYPTIVTQRRGLM|RVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLG|SQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
84 27/Apr/13 00:49  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=>Alpha-1A adrenergic receptor@_NEWLINE_@ACHRHLHSVTHYYIV|DRYIGVSYPLRYPTIVTQRRGLM|RVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLG|SQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
83 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=
77 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A
77 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A
72 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=>Alpha-1A adrenergic receptor@_NEWLINE_@ACHRHLHSVTHYYIV|DRYIGVSYPLRYPTIVTQRRGLM|RVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLG|SQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
71 24/Apr/13 03:27  /~moeller/7tmhmm/submission.php?ic1f=52&ic1t=64&ic2f=123&ic2t=143&ic3f=206&ic3t=273&ctermf=330&n=Alpha-1A adrenergic receptor&sequence=MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP TIKVHTISLS ENGEEV&loops=
2184 0.14%27/Apr/13 10:02/pzr.css
2062 0.07%27/Apr/13 03:30/~moeller/palim/
1798 0.07%26/Apr/13 12:10/qtl/cartographer.php
135 0.01%24/Apr/13 06:03  /qtl/cartographer.php?chr=1&win=20&out=20&x_value=80
116 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
112 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
111 24/Apr/13 03:27  /qtl/cartographer.php?chr=1&win=20&out=20&x_value=80
106 26/Apr/13 11:28  /qtl/cartographer.php?chr=1&win=20&out=20&x_value=80
105 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
103 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
100 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
94 26/Apr/13 07:22  /qtl/cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
93 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
92 24/Apr/13 03:27  /qtl/cartographer.php?chr=1&win=20&out=20&x_value=80
91 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
84 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=mit&cm=&win=20&out=50
84 24/Apr/13 03:27  /qtl/cartographer.php?chr=2&MRK=full&cm=&win=20&out=20
82 24/Apr/13 03:27  /qtl/cartographer.php?chr=1&win=20&out=20&x_value=80
1736 0.03%26/Apr/13 23:47/~serrano/papers/PHD/
170 26/Apr/13 01:23  /~serrano/papers/PHD/?D=A
168 26/Apr/13 23:47  /~serrano/papers/PHD/?S=A
165 24/Apr/13 03:27  /~serrano/papers/PHD/?N=D
164 24/Apr/13 03:27  /~serrano/papers/PHD/?M=A
142 24/Apr/13 03:27  /~serrano/papers/PHD/?N=A
137 24/Apr/13 03:27  /~serrano/papers/PHD/?D=D
136 24/Apr/13 03:27  /~serrano/papers/PHD/?S=D
136 24/Apr/13 03:27  /~serrano/papers/PHD/?M=D
1667 0.03%26/Apr/13 19:51/images/logo01.gif
1626 0.01%26/Apr/13 23:47/~moeller/palim/palim.php
1593 0.07%27/Apr/13 08:19/qtl.php
249 0.01%27/Apr/13 08:19  /qtl.php?species=Mus musculus&metatrait=7
233 0.01%27/Apr/13 08:19  /qtl.php?species=Mus musculus&metatrait=1
209 27/Apr/13 08:19  /qtl.php?species=Rattus norvegicus&metatrait=11
87 0.01%25/Apr/13 22:29  /qtl.php?species=Mus musculus&metatrait=8
74 24/Apr/13 04:02  /qtl.php?species=Mus musculus&metatrait=3
72 15/Apr/13 18:56  /qtl.php?species=Mus musculus&metatrait=4
72 0.01%20/Apr/13 21:22  /qtl.php?species=Mus musculus&metatrait=9
71 21/Apr/13 01:33  /qtl.php?species=Mus musculus&metatrait=2
68 21/Apr/13 22:21  /qtl.php?species=Mus musculus&metatrait=6
64 22/Apr/13 19:16  /qtl.php?species=Mus musculus&metatrait=10
61 21/Apr/13 13:18  /qtl.php?species=Mus musculus&metatrait=5
10 20/Sep/12 02:43  /qtl.php?species=Mus+musculus&metatrait=1
1547 0.07%25/Apr/13 19:03/images/headschmal01.jpg
1504 0.02%25/Apr/13 19:03/images/headschmalfill.jpg
1490 0.10%27/Apr/13 04:34/goery/goery.php
1409 0.26%27/Apr/13 06:22/~serrano/
1376 0.26%27/Apr/13 07:11/~serrano/microphone.jpeg
1315 0.03%26/Apr/13 19:51/pbicon.ico
1293 0.02%27/Apr/13 09:08/~moeller/publications/
135 26/Apr/13 23:54  /~moeller/publications/?S=D
133 27/Apr/13 00:49  /~moeller/publications/?N=D
131 26/Apr/13 23:54  /~moeller/publications/?N=A
129 26/Apr/13 23:54  /~moeller/publications/?M=D
121 27/Apr/13 00:49  /~moeller/publications/?M=A
121 24/Apr/13 03:27  /~moeller/publications/?D=D
119 24/Apr/13 03:27  /~moeller/publications/?S=A
115 24/Apr/13 03:27  /~moeller/publications/?D=A
1118 0.02%27/Apr/13 05:36/ensembl.jpg
1099 0.01%26/Apr/13 23:54/tools/umrechnung.php
1086 0.02%27/Apr/13 02:50/~moeller/soluble_variants_of_membrane_proteins/
125 27/Apr/13 01:00  /~moeller/soluble_variants_of_membrane_proteins/?M=A
121 27/Apr/13 00:49  /~moeller/soluble_variants_of_membrane_proteins/?S=A
121 24/Apr/13 03:27  /~moeller/soluble_variants_of_membrane_proteins/?D=A
119 26/Apr/13 23:54  /~moeller/soluble_variants_of_membrane_proteins/?M=D
117 26/Apr/13 23:54  /~moeller/soluble_variants_of_membrane_proteins/?S=D
113 26/Apr/13 23:54  /~moeller/soluble_variants_of_membrane_proteins/?N=A
113 27/Apr/13 02:50  /~moeller/soluble_variants_of_membrane_proteins/?D=D
113 24/Apr/13 03:27  /~moeller/soluble_variants_of_membrane_proteins/?N=D
1067 0.01%26/Apr/13 11:27/proteologo.jpg
1063 0.20%27/Apr/13 01:11/rlogo.png
1059 0.06%27/Apr/13 01:11/mole.png
1056 2.25%27/Apr/13 07:05/statistics.html
1049 0.02%26/Apr/13 11:27/logo_hpr2.gif
1048 0.01%26/Apr/13 11:27/eurome.jpg
103919.01%27/Apr/13 04:33/~serrano/papers/PDFs/Pathways/Others/Hemmer 2002.pdf
1034 0.01%26/Apr/13 11:27/phys.jpg
1031 0.04%27/Apr/13 03:13/logo01.gif
1030 0.19%26/Apr/13 11:27/exviewlogo.gif
1029 0.02%27/Apr/13 00:49/~serrano/papers/local/
119 26/Apr/13 23:54  /~serrano/papers/local/?M=D
116 27/Apr/13 00:49  /~serrano/papers/local/?N=D
115 27/Apr/13 00:49  /~serrano/papers/local/?S=A
114 24/Apr/13 03:27  /~serrano/papers/local/?D=A
111 24/Apr/13 03:27  /~serrano/papers/local/?N=A
111 24/Apr/13 03:27  /~serrano/papers/local/?S=D
109 24/Apr/13 03:27  /~serrano/papers/local/?D=D
108 24/Apr/13 03:27  /~serrano/papers/local/?M=A
1029 0.03%26/Apr/13 11:27/NavLogoModiro_small.gif
1026 0.11%26/Apr/13 11:27/mascot.jpg
1025 0.01%26/Apr/13 11:27/peaks.jpg
1023 0.01%26/Apr/13 11:27/go.jpg
1018 0.01%26/Apr/13 11:27/mascot_logo_120x50.gif
908 0.04%27/Apr/13 00:38/~moeller/mspeaks.php
827 0.08%26/Apr/13 23:45/~moeller/msms2mascot.php
757 0.07%24/Apr/13 19:50/graphclaudia.php
149 24/Apr/13 19:48  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
99 0.01%24/Apr/13 19:48  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
83 0.02%24/Apr/13 19:48  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
37 24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
30 24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
28 24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=
28 0.01%24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
27 24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=80&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
26 24/Apr/13 19:50  /graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
25 24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&debug=1
25 0.01%24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=full&out=20&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
24 0.01%24/Apr/13 19:49  /graphclaudia.php?reg=&MRK=mit&out=50&chr=2&x_value=0&win=20&species=Mus_musculus&cmap=&map=MIT_Genetic_map&bands=&ps=1
10  4/Jan/13 15:28  /graphclaudia.php?reg=&MRK=mrk&out=20&chr=1&x_value=0&win=20&species=Mus_musculus&adjust=on&cmap=&map=MIT_Genetic_map&bands=
747 0.03%26/Apr/13 23:47/~moeller/mwpi2ensembl.php
723 0.37%27/Apr/13 08:19/snpselect.php
631 0.05%27/Apr/13 08:37/~moeller/nb.html
608 0.02%26/Apr/13 10:36/qtlmix.php
587 0.06%27/Apr/13 10:02/~moeller/Steffen2.jpg
506 1.08%26/Apr/13 23:47/work_go/get_go_by_acc.php
122 0.13%24/Apr/13 03:27  /work_go/get_go_by_acc.php?termtype=cellular_component
112 0.28%24/Apr/13 03:27  /work_go/get_go_by_acc.php?termtype=biological_process
107 0.26%24/Apr/13 03:27  /work_go/get_go_by_acc.php?termtype=molecular_function
484 0.32%18/Apr/13 20:04/~serrano/papers/PDFs/Viral_Bacterial/Derfuss 2001.pdf
457 0.03%26/Apr/13 01:17/expr.jpg
447 0.02%27/Apr/13 00:17/~moeller/links.html
446 0.05%27/Apr/13 10:02/~moeller/linuxmed_logo.png
443 0.01%27/Apr/13 03:32/~gfischer/
418 0.01%27/Apr/13 00:45/~moeller/7tmhmm/
406 0.04%10/Jul/12 10:42/images/New.jpg
397 0.33%26/Apr/13 23:47/~moeller/soluble_adhesion_markers.xml
374 0.04%27/Apr/13 10:02/~moeller/Steffen1.jpg
369 5.84%25/Apr/13 16:22/~moeller/publications/thesis_moeller_cam_ac_uk_2001.doc
358 0.03%25/Apr/13 19:03/Snip.jpg
355 4.20%26/Apr/13 23:47/qtl/qtlview_eae_ms.html
348 0.01%16/Apr/13 08:57/intern/ms4700/sync_ms4700_db.log
345 0.01%26/Apr/13 12:10/~kreutzer/
343 0.01%26/Apr/13 12:10/~moeller/7tmhmm/help.php
339 0.02%26/Apr/13 20:39/qtl/
309 0.27%27/Apr/13 08:19/cartoatlas.png
298 0.16%25/Apr/13 19:03/osoranga.jpg
298 1.41%27/Apr/13 09:26/~serrano/papers/PHD/02_introduction.pdf
298 0.01%26/Apr/13 12:10/~moeller/distances.php
296 0.02%27/Apr/13 09:44/synteny.jpg
296 0.18%25/Apr/13 19:03/library.jpg
294 0.13%26/Apr/13 13:22/qtlmix_help.html
284 3.22%27/Apr/13 08:19/qtlview_eae_ms.html
280 0.01%27/Apr/13 08:19/qtlview.php
278 0.29%27/Apr/13 09:27/~serrano/berlin_paper.pdf
275 26/Apr/13 23:45/~moeller/palim/palim_visualisation.php
272 1.01%18/Apr/13 17:26/~serrano/papers/PHD/06_discussion.pdf
269 0.05%26/Oct/12 04:19/download/ShortCV_MOG.pdf
260 0.06%26/Apr/13 12:10/~moeller/soluble_adhesion_markers.html
249 0.02%26/Oct/12 11:42/supplements/
238 0.04%26/Oct/12 10:28/download/ShortCV_HJT.pdf
236 2.64%27/Apr/13 08:27/~moeller/publications/thesis_moeller_cam_ac_uk_2001.pdf
227 0.52%27/Apr/13 05:31/~serrano/papers/PDFs/Pathways/Others/Ashkar 2000.pdf
223 26/Apr/13 12:10/~moeller/interactions/interactions.php
222 24/Apr/13 03:27/~serrano/papers/
220 0.03%26/Apr/13 12:10/qtl/Mapview__Help.html
205 0.05%26/Apr/13 12:10/flexy/calc_picker_spots.php
204 0.06%24/Apr/13 22:33/qtlview_help.html
195 0.12%24/Apr/13 23:39/available/qtlmix.php.txt
195 0.11%27/Apr/13 00:16/qtl/qtlmix_help.html
194 0.10%25/Oct/12 08:53/download/Glocker_Publications_2011.pdf
193 0.11%27/Apr/13 00:30/qtl/snpselect.php
191 27/Apr/13 00:49/~db/
190 0.01%25/Oct/12 01:07/collaborators.shtml
190 0.01%26/Apr/13 14:24/~serrano/diploma2.gif
188 5.49%18/Apr/13 03:11/~serrano/papers/PHD/03_methods.pdf
188 26/Apr/13 14:24/~serrano/epo-logo.gif
180 26/Apr/13 14:24/~serrano/satantenne.jpeg
179 0.07%27/Apr/13 00:49/qtl/qtlview_help.html
178 0.02%26/Apr/13 14:24/~serrano/helix.jpg
173 0.01%26/Oct/12 03:38/contact.shtml
168 26/Apr/13 12:10/images/bmbf-nbl3-gif-en.png
168 0.01%26/Apr/13 23:46/qtl/qtlview.php
168 27/Apr/13 00:17/~reuter/
167 0.13%26/Apr/13 12:10/qtl/available/ms_sql.html
162 0.01%26/Apr/13 14:24/~serrano/girlsday02.jpg
161 0.01%26/Oct/12 06:09/ProteomForum/
158 0.14%23/Oct/12 13:19/Agenda_6th_Proteome_Forum_Rostock_2010_01.pdf
158 0.04%26/Apr/13 14:24/~serrano/journals.gif
157 24/Apr/13 03:27/~serrano/papers/login.php
157 0.01%25/Oct/12 10:51/gels.shtml
153 0.01%25/Oct/12 11:58/projects.shtml
153 0.02%26/Apr/13 14:24/~serrano/curriculum.jpg
151 0.44%26/Apr/13 14:39/~serrano/papers/PHD/01_foreword.pdf
150 0.10%27/Apr/13 00:16/~serrano/papers/local/3453453.pdf
146 27/Apr/13 01:11/intern/
144 0.11%27/Apr/13 00:16/~moeller/tmhmmgen.html
141 0.01%24/Apr/13 03:27/~moeller/soluble_variants_of_membrane_proteins/orthologous_solubles.html
140 0.01%24/Apr/13 22:33/Mapview__Help.html
139 19/Apr/13 17:44/~moeller/palim/tmpfile.png
137 0.09%20/Apr/13 04:13/~serrano/papers/PDFs/Pathways/Microarray/Eaves 2002.pdf
136 0.07%24/Apr/13 22:33/available/ms_sql.html
136 27/Apr/13 00:16/~moeller/gm.php
135 25/Oct/12 08:41/investigators.shtml
134 27/Apr/13 01:11/testcgi.html
132 0.01%25/Oct/12 20:06/ProteomForum/program.html
128 24/Apr/13 03:27/~moeller/soluble_variants_of_membrane_proteins/distribution.res.html
126 0.01%24/Oct/12 00:25/general.shtml
126 0.01%24/Apr/13 03:27/~moeller/soluble_variants_of_membrane_proteins/Rattus_norvegicus_res.html
125 0.03%26/Apr/13 12:10/~moeller/soluble_variants_of_membrane_proteins/Homo_sapiens_res.html
122 24/Oct/12 09:49/researchseminars.shtml
121 0.01%16/Apr/13 12:18/images/headschmalfill3.jpg
119 0.03%24/Apr/13 10:51/available/check.php.txt
118 21/Apr/13 02:06/available/freqdist.php.txt
117 0.02%24/Apr/13 03:27/~moeller/soluble_variants_of_membrane_proteins/Mus_musculus_res.html
116 4.58%27/Apr/13 05:32/~serrano/papers/PHD/08_published_paper.pdf
113 25/Oct/12 04:41/ProteomForum/sponsors.html
111 24/Apr/13 03:27/~serrano/papers/local/u.pl
111 0.13%24/Apr/13 03:27/~moeller/7tmhmm/coupling_predictor_moeller_vilo_croning.tar.gz
111 24/Apr/13 03:27/~serrano/papers/local/t.sh
110 0.01%24/Oct/12 09:54/techniques.shtml
109 0.02%25/Apr/13 01:18/available/ms_sql.txt
106 26/Oct/12 07:25/ProteomForum/registration.html
99 0.02%26/Apr/13 12:10/qtl/qtl_EAE_MS_mysqldump.sql.gz
99 0.01%24/Apr/13 03:27/~moeller/soluble_variants_of_membrane_proteins/human.pl.gz
99 0.01%26/Oct/12 10:17/gele/
17 15/Oct/12 22:53  /gele/?M=A
10 15/Oct/12 22:55  /gele/?S=A
10 15/Oct/12 22:58  /gele/?S=D
10 16/Oct/12 19:52  /gele/?M=D
98 0.03%24/Oct/12 09:51/gele/celegans_mutante.shtml
95 0.01%26/Apr/13 14:24/~serrano/helixb.ico
94 0.01%22/Oct/12 18:43/download/MMRP_PC_Agenda_SS_2012.pdf
94 25/Oct/12 20:43/publications.shtml
93 0.01%26/Apr/13 12:10/qtl/qtl_CIA_PIA_RA_mysqldump.sql.gz
91 0.01%26/Oct/12 06:20/press.shtml
91 0.47%25/Oct/12 13:51/download/Immunologietag_2007_local_press.pdf
88 0.40%24/Apr/13 03:27/~moeller/presentations/lissbon2004.03.ppt
88 0.03%23/Oct/12 15:17/download/Research_Seminar_SS_2012_a.pdf
86 0.11%27/Apr/13 06:30/~serrano/MS_intergenomics.pdf
86 23/Oct/12 03:29/alumni.shtml
83 24/Oct/12 09:51/links.shtml
82 0.94%26/Apr/13 06:22/~serrano/papers/PHD/07_annex.pdf
80 23/Oct/12 17:27/general6.shtml
76 26/Oct/12 07:06/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table1.html
75 27/Apr/13 01:11/proteinatlas/
75 26/Apr/13 14:39/icons/blank.gif
74 0.14%18/Mar/13 20:35/~serrano/papers/PDFs/Pathways/Others/Chabas 2003.pdf
73 25/Oct/12 11:36/general5.shtml
72 0.01%24/Oct/12 09:33/download/Faculty_Research_Seminar_WS_2011_2012_Modul_30.pdf
72 24/Oct/12 01:14/download/OZ030522.html
71 26/Apr/13 14:39/icons/back.gif
70 0.10%25/Oct/12 11:17/download/Agenda_7th_Proteome_Forum_Rostock_2011.pdf
69 0.01%20/Oct/12 07:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab_human_subsequences.ph
68 22/Oct/12 09:19/general7.shtml
68 26/Oct/12 07:20/ProteomForum/organization.html
66 4.95%10/Apr/13 14:53/~serrano/papers/PHD/05_results_part2.pdf
65  4/Jun/12 16:18/proteinatlas/tissue_map_tissue.php
24  4/Jun/12 06:52  /proteinatlas/tissue_map_tissue.php?gs=c
65 22/Apr/13 12:28/proteinatlas/tissue_map_short_all_tissues.php
24 22/Apr/13 12:27  /proteinatlas/tissue_map_short_all_tissues.php?gs=c
64 0.03%25/Oct/12 18:04/gele/human_synovia_hw.shtml
64 8.07%10/Apr/13 14:53/~serrano/papers/PHD/04_results_part1.pdf
63 0.01%24/Oct/12 09:44/gele/human_plasma_8051.shtml
62 20/Oct/12 05:24/gele/gele/
62 25/Apr/13 04:26/~gfischer/ensembl-header1.gif
61 0.29%26/Oct/12 10:39/download/Within_HRO.pdf
61 22/Apr/13 12:28/proteinatlas/tissue_map_short_cancer.php
25 22/Apr/13 12:27  /proteinatlas/tissue_map_short_cancer.php?gs=c
60 0.01%25/Oct/12 03:51/gele/celegans.shtml
59 0.04%25/Oct/12 17:31/gele/human_pannus.shtml
56 22/Oct/12 20:39/general4.shtml
56 20/Oct/12 07:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/koxprots.aln
55 0.10%23/Oct/12 19:28/gele/247_1_1_cutout_750_spots.png
54 0.12%21/Oct/12 16:28/gele/130_1_2_cut_750_spots.png
54 0.07%24/Oct/12 04:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table3.html
54 0.01%24/Oct/12 09:52/gele/mousemusculus.shtml
53 24/Oct/12 10:54/opendoor.shtml
53 0.07%21/Oct/12 16:28/gele/celegans_hole.gif
53 0.02%15/Apr/13 10:43/~kreutzer/penguin.gif
53 0.16%24/Oct/12 02:49/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab_human_subsequences_screenshot.ppt
50 0.03%23/Oct/12 04:07/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/selection.fas
50 0.01%26/Oct/12 07:16/download/PressemitteilungMeltec.pdf
49 0.04%26/Oct/12 00:49/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table2.html
49 0.01%23/Oct/12 20:12/download/Med_Faculty_Research_Seminar_SS_2011.pdf
47 20/Oct/12 21:45/le06a.htm
47 0.01%24/Oct/12 10:54/gele/human_synovia.shtml
47 0.35%25/Apr/13 10:38/~moeller/comparativegenomics_28.odt
47 2.29%12/Sep/12 07:11/proteinatlas/misc/pa_9_mysql_dump_tab_pa_tissues_normal_annotation_90.sql.gz
46 0.01%23/Oct/12 15:26/download/Press_Release_Proteome_Forum_2003.pdf
46 20/Oct/12 07:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/selection.ph
45 1.32%25/Oct/12 17:01/download/7_Proteome_Forum_Press_release_and_fotos_2011_01.pdf
45 23/Oct/12 20:11/general3.shtml
45 0.01%23/Oct/12 20:17/download/Faculty_Research_Seminar_WS_2010_11_02.pdf
45 0.05%23/Apr/13 10:23/~moeller/publications/nettab2002.pdf
44 27/Apr/13 01:11/req.png
44 0.12%23/Oct/12 15:43/gele/c_elegans_mutante_spots.gif
44 27/Apr/13 01:11/dom.png
44 27/Apr/13 01:11/type.png
44 27/Apr/13 01:11/org.png
44 27/Apr/13 01:11/size.png
44 27/Apr/13 01:11/code.png
44 27/Apr/13 01:11/dir.png
44 27/Apr/13 01:11/searchw.png
44 25/Oct/12 05:38/general2.shtml
44 27/Apr/13 01:11/os.png
44 23/Oct/12 12:53/general1.shtml
44 0.01%26/Oct/12 06:26/gele/mouseliver.shtml
43 0.75%20/Dec/12 12:52/proteinatlas/tissue_map.php
27 0.47% 8/Jun/12 12:44  /proteinatlas/tissue_map.php?gs=c
43 0.02%21/Oct/12 16:28/gele/human1label.jpg
43 0.01%26/Oct/12 00:16/download/Forschungsseminarplan_SS_2008_05.pdf
43 0.02%13/Apr/13 05:06/qtl/available/check.php.txt
43 0.04%21/Oct/12 16:28/gele/ce_hole_gele_tempshift.gif
42 0.01%21/Oct/12 16:28/gele/human2label.jpg
42 0.11%21/Oct/12 16:28/gele/c_elegans_mutante.gif
41 0.06%21/Oct/12 16:28/gele/hw1cbb.gif
41 0.08%20/Oct/12 07:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/selection.aln
41 25/Oct/12 15:00/gele/gele/gele/
41 16/Apr/13 16:42/~gfischer/example_mouse.karyo.gif
41 20/Apr/13 04:28/headschmalfill3.jpg
40 20/Oct/12 07:24/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/koxprots.fas
40 0.01%21/Oct/12 16:28/gele/murine2label.jpg
39 0.01%24/Oct/12 09:40/gele/celegans_tempshift.shtml
39 0.01%23/Oct/12 05:11/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab_human_subsequences.fas
39 0.02%25/Oct/12 15:08/download/HL_HRO.htm
39 0.01%23/Oct/12 19:01/download/OZ030404.pdf
39 0.17%14/Mar/13 12:30/~serrano/papers/PDFs/Viral_Bacterial/Schwob 2001.pdf
38 0.44%19/Dec/12 15:51/proteinatlas/tissue_map_all_cancer.php
27 0.29%19/Dec/12 15:50  /proteinatlas/tissue_map_all_cancer.php?gs=c
38 25/Apr/13 04:06/mysql.png
38 27/Apr/13 00:21/~moeller/soluble
38 26/Oct/12 11:42/ProteomForum/information.html
38 25/Oct/12 17:08/gele/c_elegans.shtml
38 0.01%23/Oct/12 17:21/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table2.rtf
36 0.78%12/Sep/12 07:30/proteinatlas/misc/pa_9_mysql_dump_tab_pa_cells_90.sql.gz
36 0.24% 7/Oct/12 02:20/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab-human-kachelA.ppt
36 1.86%14/Sep/12 06:04/proteinatlas/misc/pa_mysql_dump_90.tar.gz
36 25/Oct/12 13:07/download/Forschungsseminarplan_WS_2008_09_04.pdf
34 18/Apr/13 06:56/freqdist.png
34 20/Oct/12 11:31/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/koxprots.ph
33 22/Oct/12 12:48/download/HH_HRO.pdf
33 25/Oct/12 13:06/download/Forschungsseminarplan_WS_2009_10.pdf
33 0.09%23/Oct/12 20:01/download/Mamma_Ca_OZ_15022008.pdf
33 24/Oct/12 05:53/gele/adrheader.html
32 0.08%25/Oct/12 17:38/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab_human_subsequences.aln
32 26/Apr/13 14:39/icons/layout.gif
31 0.01%13/Apr/13 19:38/folder_htm.jpg
31 0.02%22/Oct/12 19:21/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table3.rtf
31 26/Oct/12 06:09/ProteomForum/contact.html
31 0.01%14/Oct/12 22:34/download/B_HRO.pdf
31 23/Apr/13 10:45/folder.jpg
30 0.02%21/Apr/13 15:07/Workflow2.jpg
30 23/Oct/12 07:53/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/koxprots.pdf
29 26/Apr/13 12:10/intern/update_databases.html
29 0.76%25/Oct/12 12:38/download/3rd_proteome_forum_Rostock_2007_press_01.pdf
28  8/Jun/12 12:44/proteinatlas/index.php
28 0.01%20/Apr/13 04:31/Ruler.png
28 18/Mar/13 10:45/qtl/available/freqdist.php.txt
27 21/Oct/12 22:15/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/selection.pdf
27 0.48%28/Nov/12 11:33/proteinatlas/misc/pa_mysql_dump_100.tar.gz
27 0.01%31/Mar/13 12:40/qtl/available/ms_sql.txt
26 0.02%21/Oct/12 20:48/Agenda_of_the_6th_Proteome_Forum_Rostock_2010.pdf
26 0.01%15/Oct/12 04:44/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table2.doc
26 26/Oct/12 07:25/gele/celegans_mutante.txt
26 22/Oct/12 11:26/gele/human.shtml
26 0.03%24/Oct/12 02:49/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/krab_human_subsequences.pdf
25 24/Oct/12 09:49/gele/human_plasma.txt
25 0.05%22/Oct/12 19:02/download/WEG_ins_PZR.pdf
25 0.01%19/Apr/13 07:35/folder_csv.jpg
25 24/Sep/12 15:54/joolims/administrator/index.php
24 0.05%20/Apr/13 04:31/help2-300.png
24 0.04%15/Oct/12 22:39/gele/85_1_1_spots.gif
24 0.44%23/Oct/12 14:10/download/6_Proteome_Forum_2010.pdf
23 0.02%31/Mar/13 11:57/qtl/available/qtlmix.php.txt
23 0.02%22/Apr/13 12:28/proteinatlas/tissue_map_cancer.php
18 0.02%28/Sep/12 11:20  /proteinatlas/tissue_map_cancer.php?gs=c
22 20/Oct/12 10:51/images/pmclogo.gif
22 23/Oct/12 19:26/gele/ce_tempshift_prot.csv
22 20/Mar/13 06:56/intern/ms4700/sync_ms4700_db_del_log.php
22  7/Jan/13 07:31/intern/diskusage_new.php
21 0.01% 7/Oct/12 02:23/supplements/Rousseau_Merck_2002_CytogenetGenommeResearch/table3.doc
21 26/Apr/13 12:10/~moeller/foaf.rdf
21 15/Oct/12 22:35/images/Hupo_logo.gif
20 15/Oct/12 22:36/images/BGhome2.jpg
20 15/Oct/12 22:36/images/Shimadzu-Logo.gif
20 0.06%16/Oct/12 19:48/bilder/pzr.png
20 11/Apr/13 22:38/qtl_CIA_PIA_RA_mysqldump.sql.gz
20 0.02%10/Apr/13 20:17/~serrano/papers/PDFs/Pathways/Chemokines-Estradiol/Matejuk 2002.pdf
20 12/Apr/13 18:04/qtl_EAE_MS_mysqldump.sql.gz
20 15/Oct/12 22:35/images/hallelogo.gif
3225 8.94%27/Apr/13 00:22[not listed: 616 files]